Mouse Anti-Arabidopsis AK9 Antibody (CBMOAB-1987FYC)


Cat: CBMOAB-1987FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO1987FC
SpecificityThis antibody binds to Arabidopsis AK9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene catalyzes the interconversion of nucleosides, possessing both nucleoside monophosphate and diphosphate kinase activities. The encoded protein uses these interconversions to maintain nucleoside homeostasis.
Product OverviewMouse Anti-Arabidopsis AK9 Antibody is a mouse antibody against AK9. It can be used for AK9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate Kinase 9; Adenylate Kinase Domain Containing 2; Adenylate Kinase Domain Containing 1; C6orf199; C6orf224; AK 9; AKD1; AKD2
UniProt IDQ38996
Protein RefseqThe length of the protein is 59 amino acids long. The sequence is show below: KASNILLDQEMNPEIADFGLAKLFDTDQTSTHRFTSKIAGTYGYMAPEYAIYGQFSVKT.
See other products for " ak9 "
For Research Use Only | Not For Clinical Use.
Online Inquiry