Mouse Anti-AK9 Antibody (CBMOAB-1987FYC)
Cat: CBMOAB-1987FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Zebrafish (Danio rerio) |
| Clone | MO1987FC |
| Specificity | This antibody binds to Arabidopsis AK9. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene catalyzes the interconversion of nucleosides, possessing both nucleoside monophosphate and diphosphate kinase activities. The encoded protein uses these interconversions to maintain nucleoside homeostasis. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis AK9 Antibody is a mouse antibody against AK9. It can be used for AK9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Adenylate Kinase 9; Adenylate Kinase Domain Containing 2; Adenylate Kinase Domain Containing 1; C6orf199; C6orf224; AK 9; AKD1; AKD2 |
| UniProt ID | Q38996 |
| Protein Refseq | The length of the protein is 59 amino acids long. The sequence is show below: KASNILLDQEMNPEIADFGLAKLFDTDQTSTHRFTSKIAGTYGYMAPEYAIYGQFSVKT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry