Mouse Anti-AK9 Antibody (CBMOAB-1987FYC)
Cat: CBMOAB-1987FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Zebrafish (Danio rerio) |
Clone | MO1987FC |
Specificity | This antibody binds to Arabidopsis AK9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene catalyzes the interconversion of nucleosides, possessing both nucleoside monophosphate and diphosphate kinase activities. The encoded protein uses these interconversions to maintain nucleoside homeostasis. |
Product Overview | Mouse Anti-Arabidopsis AK9 Antibody is a mouse antibody against AK9. It can be used for AK9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenylate Kinase 9; Adenylate Kinase Domain Containing 2; Adenylate Kinase Domain Containing 1; C6orf199; C6orf224; AK 9; AKD1; AKD2 |
UniProt ID | Q38996 |
Protein Refseq | The length of the protein is 59 amino acids long. The sequence is show below: KASNILLDQEMNPEIADFGLAKLFDTDQTSTHRFTSKIAGTYGYMAPEYAIYGQFSVKT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry