AibGenesis™ Mouse Anti-ARPC1A Antibody (CBMOAB-2680FYC)
Cat: CBMOAB-2680FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-2680FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Zebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta) | WB, ELISA | MO2680FC | 100 µg | ||
| CBMOAB-36288FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36288FYA | 100 µg | ||
| CBMOAB-66586FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO66586FYA | 100 µg | ||
| MO-AB-07620R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07620R | 100 µg | ||
| MO-AB-24092W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24092W | 100 µg | ||
| MO-AB-24180H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24180C | 100 µg | ||
| MO-AB-51328W | Monoclonal | Marmoset | WB, ELISA | MO51328W | 100 µg | ||
| MO-DKB-03423W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio) | WB, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Zebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta) |
| Clone | MO2680FC |
| Specificity | This antibody binds to Arabidopsis ARPC1A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytoskeleton; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1B. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis ARPC1A Antibody is a mouse antibody against ARPC1A. It can be used for ARPC1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Actin Related Protein 2/3 Complex Subunit 1A; SOP2-Like Protein; Actin Binding Protein (Schizosaccharomyces Pombe Sop2-Like); SOP2L; Actin Related Protein 2/3 Complex, Subunit 1A (41 KD); Actin Related Protein 2/3 Complex, Subunit 1A, 41kDa; Actin Related Protein 2/3 Complex Subunit 1A, 41kDa; Actin-Related Protein 2/3 Complex Subunit 1A |
| UniProt ID | F4IPT5 |
| Protein Refseq | The length of the protein is 378 amino acids long. The sequence is show below: MAVVDVHRFAESITCHAWSPDLSMVALCPNNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSLEGAEWVPTLVILRLNRAALCVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATTSTDGKCRVFSTFIKGVDTKYAHYLNGAFFLLKQQILQLDLSYSWAFGVKWSPSGNTLAYVGHSSMIYFVDDVGPSPLAQSVAFRDLPLRDVLFISEKMVIGVGYDSNPMVFASDDTGIWSFIRYIGEKKAASSNSSYSSQFSEAFGKFYGSQSKSTTANDASESRGGVHDNCINSIVSLSKAGSPKVMRFSTSGLDGKVAIWDLENMEQELGNQF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry