AibGenesis™ Mouse Anti-BBR / BPC6 Antibody (CBMOAB-25087FYC)


Cat: CBMOAB-25087FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25087FYC Monoclonal A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Cottonwood (Populus deltoids) WB, ELISA MO25087FC 100 µg
Inquiry
MO-AB-00051W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00051W 100 µg
Inquiry
MO-AB-27252W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27252W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Cottonwood (Populus deltoids)
CloneMO25087FC
SpecificityThis antibody binds to Arabidopsis BBR / BPC6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis BBR / BPC6 Antibody is a mouse antibody against BBR / BPC6. It can be used for BBR / BPC6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGAGA-binding transcriptional activator; Fragment; BBR/BPC6
UniProt IDQ2PQR9
Protein RefseqThe length of the protein is 36 amino acids long. The sequence is show below: MDDGGHRENGRHKAAVQGQWLMQHQPSMKQVMSIIA.
For Research Use Only | Not For Clinical Use.
Online Inquiry