Mouse Anti-BCAT2 Antibody (CBMOAB-25107FYC)
Cat: CBMOAB-25107FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-25107FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) | WB, ELISA | MO25107FC | 100 µg | ||
CBMOAB-67539FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67539FYA | 100 µg | ||
MO-AB-07722W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07722W | 100 µg | ||
MO-AB-10309W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10309W | 100 µg | ||
MO-AB-29218W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29218W | 100 µg | ||
MO-AB-41311W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41311W | 100 µg | ||
MO-AB-43841W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43841W | 100 µg | ||
MO-AB-51796W | Monoclonal | Marmoset | WB, ELISA | MO51796W | 100 µg | ||
MO-AB-08004R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO08004R | 100 µg | ||
MO-AB-24099R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24099R | 100 µg | ||
MO-AB-01818H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01818C | 100 µg | ||
MO-AB-00155L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00155L | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) |
Clone | MO25107FC |
Specificity | This antibody binds to Arabidopsis BCAT2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Chloroplast |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
Product Overview | Mouse Anti-Arabidopsis BCAT2 Antibody is a mouse antibody against BCAT2. It can be used for BCAT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Branched Chain Amino Acid Transaminase 2; Branched Chain Aminotransferase 2, Mitochondrial; Placental Protein 18; EC 2.6.1.42; BCATM; PP18; BCT2 |
UniProt ID | Q9M439 |
Protein Refseq | The length of the protein is 388 amino acids long. The sequence is show below: MIKTITSLRKTLVLPLHLHIRTLQTFAKYNAQAASALREERKKPLYQNGDDVYADLDWDNLGFGLNPADYMYVMKCSKDGEFTQGELSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKENGKLLLFRPDHNAIRMKLGAERMLMPSPSVDQFVNAVKQTALANKRWVPPAGKGTLYIRPLLMGSGPILGLGPAPEYTFIVYASPVGNYFKEGMAALNLYVEEEYVRAAPGGAGGVKSITNYAPVLKALSRAKSRGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITRKSVMEIASDQGYQVVEKAVHVDEVMDADEVFCTGTAVVVAPVGTITYQEKRVEYKTGDESVCQKLRSVLVGIQTGLIEDNKGWVTDIN. |
See other products for " BCAT2 "
MO-AB-14354Y | Mouse Anti-BCAT2 Antibody (MO-AB-14354Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry