Mouse Anti-Arabidopsis CKS2 Antibody (CBMOAB-26186FYC)


Cat: CBMOAB-26186FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO26186FC
SpecificityThis antibody binds to Arabidopsis CKS2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein.
Product OverviewMouse Anti-Arabidopsis CKS2 (clone MO26186FC) Antibody (CBMOAB-26186FYC) is a mouse antibody against CKS2. It can be used for CKS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCDC28 Protein Kinase Regulatory Subunit 2; CDC28 Protein Kinase 2; CKS-2; CKS1(S. Cerevisiae Cdc28/Cdc2 Kinase Subunit) Homolog-2; Cyclin-Dependent Kinases Regulatory Subunit 2; CKSHS2
UniProt IDQ9SJJ5
Protein RefseqThe length of the protein is 83 amino acids long. The sequence is show below: MGQIQYSDKYFDDTFEYRHVVLPPEVAKLLPKNRILSESEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQEHQAQIAK.
For Research Use Only | Not For Clinical Use.

Online Inquiry