Cat: CBMOAB-26186FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO26186FC |
Specificity | This antibody binds to Arabidopsis CKS2. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. |
Product Overview | Mouse Anti-Arabidopsis CKS2 (clone MO26186FC) Antibody (CBMOAB-26186FYC) is a mouse antibody against CKS2. It can be used for CKS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CDC28 Protein Kinase Regulatory Subunit 2; CDC28 Protein Kinase 2; CKS-2; CKS1(S. Cerevisiae Cdc28/Cdc2 Kinase Subunit) Homolog-2; Cyclin-Dependent Kinases Regulatory Subunit 2; CKSHS2 |
UniProt ID | Q9SJJ5 |
Protein Refseq | The length of the protein is 83 amino acids long. The sequence is show below: MGQIQYSDKYFDDTFEYRHVVLPPEVAKLLPKNRILSESEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQEHQAQIAK. |
See other products for " CKS2 "
MO-AB-24624R | Mouse Anti-Pig CKS2 Antibody (MO-AB-24624R) |
MO-AB-02428H | Mouse Anti-Frog cks2 Antibody (MO-AB-02428H) |
MO-AB-24811H | Mouse Anti-Rat Cks2 Antibody (MO-AB-24811H) |
MO-AB-00218L | Mouse Anti-Elephant CKS2 Antibody (MO-AB-00218L) |
MO-AB-07922W | Mouse Anti-Cat CKS2 Antibody (MO-AB-07922W) |
MO-AB-10930Y | Mouse Anti-O. mykiss CKS2 Antibody (MO-AB-10930Y) |
MO-AB-12346W | Mouse Anti-Chimpanzee CKS2 Antibody (MO-AB-12346W) |
MO-AB-14582Y | Mouse Anti-Sheep CKS2 Antibody (MO-AB-14582Y) |
MO-AB-10274R | Mouse Anti-Cattle CKS2 Antibody (MO-AB-10274R) |
MO-AB-53081W | Mouse Anti-Marmoset CKS2 Antibody (MO-AB-53081W) |
For Research Use Only | Not For Clinical Use.