AibGenesis™ Mouse Anti-CKS2 Antibody (CBMOAB-26186FYC)
Cat: CBMOAB-26186FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-26186FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Frog (Xenopus laevis), Human (Homo sapiens), Bovine (Bos taurus), Rhesus (Macaca mulatta), Frog (Xenopus), Mallard (Anas platyrhynchos), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO26186FC | 100 µg | ||
| CBMOAB-70628FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO70628FYA | 100 µg | ||
| MO-AB-00218L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00218L | 100 µg | ||
| MO-AB-00368H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00368C | 100 µg | ||
| MO-AB-02428H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02428C | 100 µg | ||
| MO-AB-07922W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07922W | 100 µg | ||
| MO-AB-10274R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10274R | 100 µg | ||
| MO-AB-10930Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10930Y | 100 µg | ||
| MO-AB-12346W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12346W | 100 µg | ||
| MO-AB-14582Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14582Y | 100 µg | ||
| MO-AB-23042H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23042C | 100 µg | ||
| MO-AB-24624R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24624R | 100 µg | ||
| MO-AB-24811H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24811C | 100 µg | ||
| MO-AB-53081W | Monoclonal | Marmoset | WB, ELISA | MO53081W | 100 µg | ||
| MO-DKB-01313W | Polyclonal | Human (Homo sapiens), Bovine (Bos taurus), Rhesus (Macaca mulatta), Frog (Xenopus) | WB, IF | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Frog (Xenopus laevis), Human (Homo sapiens), Bovine (Bos taurus), Rhesus (Macaca mulatta), Frog (Xenopus), Mallard (Anas platyrhynchos), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO26186FC |
| Specificity | This antibody binds to Arabidopsis CKS2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis CKS2 Antibody is a mouse antibody against CKS2. It can be used for CKS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CDC28 Protein Kinase Regulatory Subunit 2; CDC28 Protein Kinase 2; CKS-2; CKS1(S. Cerevisiae Cdc28/Cdc2 Kinase Subunit) Homolog-2; Cyclin-Dependent Kinases Regulatory Subunit 2; CKSHS2 |
| UniProt ID | Q9SJJ5 |
| Protein Refseq | The length of the protein is 83 amino acids long. The sequence is show below: MGQIQYSDKYFDDTFEYRHVVLPPEVAKLLPKNRILSESEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQEHQAQIAK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry