Mouse Anti-FH Antibody (CBMOAB-33245FYC)


Cat: CBMOAB-33245FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-33245FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Sheep (Ovis aries), Zebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta), Zebrafish WB, ELISA MO33245FC 100 µg
CBMOAB-42890FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO42890FYA 100 µg
CBMOAB-61866FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO61866FYC 100 µg
CBMOAB-76493FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76493FYA 100 µg
MO-AB-12566R Monoclonal Cattle (Bos taurus) WB, ELISA MO12566R 100 µg
MO-AB-15280Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15280Y 100 µg
MO-AB-25845R Monoclonal Pig (Sus scrofa) WB, ELISA MO25845R 100 µg
MO-AB-26748W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26748W 100 µg
MO-AB-55464W Monoclonal Marmoset WB, ELISA MO55464W 100 µg
MOFAB-486W Monoclonal Zebrafish WB, IHC, IP 100 µg
MO-NAB-00452W Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Sheep (Ovis aries), Zebrafish (Danio rerio) WB, IF NW0377 100 µg
MO-DKB-03158W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Sheep (Ovis aries), Zebrafish (Danio rerio) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Sheep (Ovis aries), Zebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta), Zebrafish
CloneMO33245FC
SpecificityThis antibody binds to Arabidopsis FH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Chloroplast; Mitochondrion; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy. (From NCBI)
Product OverviewMouse Anti-Arabidopsis FH Antibody is a mouse antibody against FH. It can be used for FH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFumarate Hydratase; EC 4.2.1.2; Fumarase; Fumarate Hydratase, Mitochondrial; HLRCC; MCUL1; FMRD; LRCC; MCL
UniProt IDQ9ZR07
Protein RefseqThe length of the protein is 187 amino acids long. The sequence is show below: MATASRFLLRKLPRFLKLSPTLLRSNGVRVSSNLIQDSIEPLDSFWRIGSRIRHDSLTTRSFSSQGPASVDYSSVLQEEEFHKLANFTINHLLEKIEDYGDNVQIDGFDIDYGNEVLTLKLGSLGTYVLNKQTPNRQIWMSSPVSGPSRFDWDRDANAWIYRRTEAKLHKLLEEELENLCGEPIQLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry