AibGenesis™ Mouse Anti-FH Antibody (CBMOAB-33245FYC)
Cat: CBMOAB-33245FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-33245FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Sheep (Ovis aries), Zebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta), Zebrafish | WB, ELISA | MO33245FC | 100 µg | ||
| CBMOAB-42890FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO42890FYA | 100 µg | ||
| CBMOAB-61866FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO61866FYC | 100 µg | ||
| CBMOAB-76493FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO76493FYA | 100 µg | ||
| MO-AB-12566R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12566R | 100 µg | ||
| MO-AB-15280Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15280Y | 100 µg | ||
| MO-AB-25845R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25845R | 100 µg | ||
| MO-AB-26748W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26748W | 100 µg | ||
| MO-AB-55464W | Monoclonal | Marmoset | WB, ELISA | MO55464W | 100 µg | ||
| MOFAB-486W | Monoclonal | Zebrafish | WB, IHC, IP | 100 µg | |||
| MO-NAB-00452W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, IF | NW0377 | 100 µg | ||
| MO-DKB-03158W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, IF, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Sheep (Ovis aries), Zebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta), Zebrafish |
| Clone | MO33245FC |
| Specificity | This antibody binds to Arabidopsis FH. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Chloroplast; Mitochondrion; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis FH Antibody is a mouse antibody against FH. It can be used for FH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Fumarate Hydratase; EC 4.2.1.2; Fumarase; Fumarate Hydratase, Mitochondrial; HLRCC; MCUL1; FMRD; LRCC; MCL |
| UniProt ID | Q9ZR07 |
| Protein Refseq | The length of the protein is 187 amino acids long. The sequence is show below: MATASRFLLRKLPRFLKLSPTLLRSNGVRVSSNLIQDSIEPLDSFWRIGSRIRHDSLTTRSFSSQGPASVDYSSVLQEEEFHKLANFTINHLLEKIEDYGDNVQIDGFDIDYGNEVLTLKLGSLGTYVLNKQTPNRQIWMSSPVSGPSRFDWDRDANAWIYRRTEAKLHKLLEEELENLCGEPIQLS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry