AibGenesis™ Mouse Anti-LCR22 Antibody (CBMOAB-35672FYC)


Cat: CBMOAB-35672FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35672FYC Monoclonal A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata) WB, ELISA MO35672FC 100 µg
Inquiry
MO-AB-00636H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00636C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata)
CloneMO35672FC
SpecificityThis antibody binds to Arabidopsis LCR22.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis LCR22 Antibody is a mouse antibody against LCR22. It can be used for LCR22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative defensin-like protein 157; Putative low-molecular-weight cysteine-rich protein 22; Protein LCR22; LCR22; At4g29280
UniProt IDQ9M0F3
Protein RefseqThe length of the protein is 77 amino acids long. The sequence is show below: MAKISCSSFFVLMLVFSVFSLVEKAKGDERCTIIIHPGSPCDPSDCVQYCYAEYNGVGKCIASKPGRSANCMCTYNC.
For Research Use Only | Not For Clinical Use.
Online Inquiry