AibGenesis™ Mouse Anti-LCR31 Antibody (CBMOAB-35682FYC)
Cat: CBMOAB-35682FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata) |
| Clone | MO35682FC |
| Specificity | This antibody binds to Arabidopsis LCR31. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis LCR31 Antibody is a mouse antibody against LCR31. It can be used for LCR31 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Defensin-like protein 153; Low-molecular-weight cysteine-rich protein 31; Protein LCR31; LCR31; At1g28335 |
| UniProt ID | P82746 |
| Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: MKNVSQVSVAVLLIFSILVLGIGVQGKVPCLSRMFNKNNTCSFLRCEANCARKYKGYGDCRPGDRPHDKKDSLFCFCNYPC. |
For Research Use Only | Not For Clinical Use.
Online Inquiry