AibGenesis™ Mouse Anti-LCR31 Antibody (CBMOAB-35682FYC)


Cat: CBMOAB-35682FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35682FYC Monoclonal A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata) WB, ELISA MO35682FC 100 µg
Inquiry
MO-AB-00641H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00641C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata)
CloneMO35682FC
SpecificityThis antibody binds to Arabidopsis LCR31.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis LCR31 Antibody is a mouse antibody against LCR31. It can be used for LCR31 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDefensin-like protein 153; Low-molecular-weight cysteine-rich protein 31; Protein LCR31; LCR31; At1g28335
UniProt IDP82746
Protein RefseqThe length of the protein is 81 amino acids long. The sequence is show below: MKNVSQVSVAVLLIFSILVLGIGVQGKVPCLSRMFNKNNTCSFLRCEANCARKYKGYGDCRPGDRPHDKKDSLFCFCNYPC.
For Research Use Only | Not For Clinical Use.
Online Inquiry