Mouse Anti-MT3 Antibody (CBMOAB-36779FYC)
Cat: CBMOAB-36779FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
- Relate Reference Data
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36779FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Goat (Capra hircus), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO36779FC | 100 µg | ||
| MO-AB-31837W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31837W | 100 µg | ||
| MO-AB-37720W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37720W | 100 µg | ||
| MO-AB-45569W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45569W | 100 µg | ||
| MO-AB-59459W | Monoclonal | Marmoset | WB, ELISA | MO59459W | 100 µg | ||
| MO-AB-16126R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16126R | 100 µg | ||
| MO-AB-27279H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27279C | 100 µg | ||
| MO-AB-00824L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00824L | 100 µg | ||
| MO-AB-06648Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06648Y | 100 µg | ||
| MO-AB-08875Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08875Y | 100 µg | ||
| MO-AB-16205Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO16205Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Goat (Capra hircus), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO36779FC |
| Specificity | This antibody binds to Arabidopsis MT3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions. This gene family member displays tissue-specific expression, and contains a threonine insert near its N-terminus and a glutamate-rich hexapeptide insert near its C-terminus relative to the proteins encoded by other gene family members. It plays an important role in zinc and copper homeostasis, and is induced under hypoxic conditions. The encoded protein is a growth inhibitory factor, and reduced levels of the protein are observed in the brains of individuals with some metal-linked neurodegenerative disorders such as Alzheimer's disease. |
| Product Overview | Mouse Anti-Arabidopsis MT3 Antibody is a mouse antibody against MT3. It can be used for MT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Metallothionein 3; Metallothionein 3 (Growth Inhibitory Factor (Neurotrophic)); Growth Inhibitory Factor; Metallothionein-III; GIFB; GIF |
| UniProt ID | O22433 |
| Protein Refseq | The length of the protein is 69 amino acids long. The sequence is show below: MSSNCGSCDCADKTQCVKKGTSYTFDIVETQESYKEAMIMDVGAEENNANCKCKCGSSCSCVNCTCCPN. |
Reference
| Reference | 1. Guo, W. J., Bundithya, W., & Goldsbrough, P. B. (2003). Characterization of the Arabidopsis metallothionein gene family: tissue-specific expression and induction during senescence and in response to copper. New Phytologist, 369-381. 2. Bundithya, W. (1999). Expression of metallothionein genes in Arabidopsis (Doctoral dissertation, Purdue University). 3. Zimeri, A. M., Dhankher, O. P., McCaig, B., & Meagher, R. B. (2005). The plant MT1 metallothioneins are stabilized by binding cadmiums and are required for cadmium tolerance and accumulation. Plant molecular biology, 58, 839-855. |
Relate Reference Data
Figure 1 Comparison of the metal tolerance of yeast expressing MT3 cDNAs of T. caerulescens and A. thaliana. Three-day-growth in solid medium (A) not supplemented (Cont) or supplemented by heavy metals (Cd2+, Cu2+, and Zn2+) of yeast transformed by pYX212 (1), pYX212-TcPCS (2), pYX212-TcMT3 (3), and pYX212-AtMT3 (4).
Reference: Roosens, N. H., Bernard, C., Leplae, R., & Verbruggen, N. (2004). Evidence for copper homeostasis function of metallothionein (MT3) in the hyperaccumulator Thlaspi caerulescens. FEBS letters, 577(1-2), 9-16.
Figure 2 Analysis of plant MT3 production in yeast. Western blot analysis was performed with total protein extract of yeast expressing AtMT3:V5 (1) and TcMT3:V5 (2) grown 14 h in liquid minimal medium supplemented by heavy metals (60 μM CdSO4 (Cd) or 150 μM CuSO4 (Cu)).
Reference: Roosens, N. H., Bernard, C., Leplae, R., & Verbruggen, N. (2004). Evidence for copper homeostasis function of metallothionein (MT3) in the hyperaccumulator Thlaspi caerulescens. FEBS letters, 577(1-2), 9-16.
For Research Use Only | Not For Clinical Use.
Online Inquiry