Mouse Anti-MT3 Antibody (CBMOAB-36779FYC)


Cat: CBMOAB-36779FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36779FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Goat (Capra hircus), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO36779FC 100 µg
MO-AB-31837W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31837W 100 µg
MO-AB-37720W Monoclonal Goat (Capra hircus) WB, ELISA MO37720W 100 µg
MO-AB-45569W Monoclonal Horse (Equus caballus) WB, ELISA MO45569W 100 µg
MO-AB-59459W Monoclonal Marmoset WB, ELISA MO59459W 100 µg
MO-AB-16126R Monoclonal Cattle (Bos taurus) WB, ELISA MO16126R 100 µg
MO-AB-27279H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27279C 100 µg
MO-AB-00824L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00824L 100 µg
MO-AB-06648Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06648Y 100 µg
MO-AB-08875Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08875Y 100 µg
MO-AB-16205Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16205Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Goat (Capra hircus), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO36779FC
SpecificityThis antibody binds to Arabidopsis MT3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions. This gene family member displays tissue-specific expression, and contains a threonine insert near its N-terminus and a glutamate-rich hexapeptide insert near its C-terminus relative to the proteins encoded by other gene family members. It plays an important role in zinc and copper homeostasis, and is induced under hypoxic conditions. The encoded protein is a growth inhibitory factor, and reduced levels of the protein are observed in the brains of individuals with some metal-linked neurodegenerative disorders such as Alzheimer's disease. (From NCBI)
Product OverviewMouse Anti-Arabidopsis MT3 Antibody is a mouse antibody against MT3. It can be used for MT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMetallothionein 3; Metallothionein 3 (Growth Inhibitory Factor (Neurotrophic)); Growth Inhibitory Factor; Metallothionein-III; GIFB; GIF
UniProt IDO22433
Protein RefseqThe length of the protein is 69 amino acids long. The sequence is show below: MSSNCGSCDCADKTQCVKKGTSYTFDIVETQESYKEAMIMDVGAEENNANCKCKCGSSCSCVNCTCCPN.

Reference

Reference1. Guo, W. J., Bundithya, W., & Goldsbrough, P. B. (2003). Characterization of the Arabidopsis metallothionein gene family: tissue-specific expression and induction during senescence and in response to copper. New Phytologist, 369-381.
2. Bundithya, W. (1999). Expression of metallothionein genes in Arabidopsis (Doctoral dissertation, Purdue University).
3. Zimeri, A. M., Dhankher, O. P., McCaig, B., & Meagher, R. B. (2005). The plant MT1 metallothioneins are stabilized by binding cadmiums and are required for cadmium tolerance and accumulation. Plant molecular biology, 58, 839-855.
For Research Use Only | Not For Clinical Use.
Online Inquiry