AibGenesis™ Mouse Anti-PPME1 Antibody (CBMOAB-39257FYC)
Cat: CBMOAB-39257FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39257FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Nile tilapia (Oreochromis niloticus), Zebrafish (Danio rerio) | WB, ELISA | MO39257FC | 100 µg | ||
| CBMOAB-93578FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO93578FYA | 100 µg | ||
| MO-AB-01159L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01159L | 100 µg | ||
| MO-AB-03534Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03534Y | 100 µg | ||
| MO-AB-06472H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06472C | 100 µg | ||
| MO-AB-18344R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO18344R | 100 µg | ||
| MO-AB-23196W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23196W | 100 µg | ||
| MO-AB-32841W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO32841W | 100 µg | ||
| MO-AB-33660H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33660C | 100 µg | ||
| MO-AB-35494W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35494W | 100 µg | ||
| MO-AB-46144W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46144W | 100 µg | ||
| MO-AB-62075W | Monoclonal | Marmoset | WB, ELISA | MO62075W | 100 µg | ||
| MO-DKB-01141W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rhesus (Macaca mulatta) | WB, IHC, IHC-P | 100 µg | |||
| MO-DKB-01390W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta) | WB, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Nile tilapia (Oreochromis niloticus), Zebrafish (Danio rerio) |
| Clone | MO39257FC |
| Specificity | This antibody binds to Arabidopsis PPME1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Golgi apparatus; Endoplasmic reticulum; Other locations; Cell wall; Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis PPME1 Antibody is a mouse antibody against PPME1. It can be used for PPME1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Pectinesterase PPME1; AtPPME1; PE PPME1; EC 3.1.1.11; Pectin methylesterase 9; AtPME9; Pectin methylesterase PPME1; Protein POLLEN SPECIFIC PME 1; PPME1; ARATH9; At1g69940 |
| UniProt ID | Q84WM7 |
| Protein Refseq | The length of the protein is 361 amino acids long. The sequence is show below: MGYTNVSILLGLLMVFVTPMVFADDVTPIPEGKPQVAQWFNANVGPLAQRKGLDPALVAAEAAPRIINVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVIAAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQENKTPAHDKTVFYGEYKCSGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPPPAL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry