AibGenesis™ Mouse Anti-PSBH Antibody (CBMOAB-39419FYC)
Cat: CBMOAB-39419FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39419FYC | Monoclonal | WB, ELISA | MO39419FC | 100 µg | |||
| CBMOAB-88935FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88935FYB | 100 µg | ||
| MO-AB-00513W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00513W | 100 µg | ||
| MO-AB-27986W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27986W | 100 µg | ||
| MO-AB-36422W | Monoclonal | French-bean | WB, ELISA | MO36422W | 100 µg | ||
| MO-AB-00807H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00807C | 100 µg | ||
| MO-AB-30491H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30491C | 100 µg | ||
| MO-DKB-0425RA | Polyclonal | WB | 100 µL | ||||
| MO-DKB-01725W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); H. vulgare (Hordeum vulgare); P. strobus (Pinus strobus); Spinach (Spinacia oleracea), Arabidopsis (Arabidopsis lyrata), Barrel medic (Medicago truncatula), Cottonwood (Populus deltoids), French-bean, Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO39419FC |
| Specificity | This antibody binds to Arabidopsis PSBH. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis PSBH Antibody is a mouse antibody against PSBH. It can be used for PSBH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Photosystem II reaction center protein H; PSII-H; Photosystem II 10 kDa phosphoprotein; psbH; AtCg00710 |
| UniProt ID | P56780 |
| Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: MATQTVEDSSRSGPRSTTVGKLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISVN. |
Reference
| Reference | 1. Meierhoff, K., Felder, S., Nakamura, T., Bechtold, N., & Schuster, G. (2003). HCF152, an Arabidopsis RNA binding pentatricopeptide repeat protein involved in the processing of chloroplast psbB-psbT-psbH-petB-petD RNAs. The Plant Cell, 15(6), 1480-1495. 2. Felder, S., Meierhoff, K., Sane, A. P., Meurer, J., Driemel, C., Plücken, H., ... & Westhoff, P. (2001). The nucleus-encoded HCF107 gene of Arabidopsis provides a link between intercistronic RNA processing and the accumulation of translation-competent psbH transcripts in chloroplasts. The Plant Cell, 13(9), 2127-2141. |
See other products for " PsbH "
For Research Use Only | Not For Clinical Use.
Online Inquiry