AibGenesis™ Mouse Anti-PSBM Antibody (CBMOAB-39426FYC)
Cat: CBMOAB-39426FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39426FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) | WB, ELISA | MO39426FC | 100 µg | ||
| CBMOAB-88943FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88943FYB | 100 µg | ||
| MO-AB-00518W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00518W | 100 µg | ||
| MO-AB-01912L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01912L | 100 µg | ||
| MO-AB-27988W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27988W | 100 µg | ||
| MO-AB-30496H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30496C | 100 µg | ||
| MO-AB-39435W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39435W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO39426FC |
| Specificity | This antibody binds to Arabidopsis PSBM. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis PSBM Antibody is a mouse antibody against PSBM. It can be used for PSBM detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Photosystem II reaction center protein M; PSII-M; psbM; AtCg00220 |
| UniProt ID | P62109 |
| Protein Refseq | The length of the protein is 34 amino acids long. The sequence is show below: MEVNILAFIATALFILVPTAFLLIIYVKTVSQND. |
For Research Use Only | Not For Clinical Use.
Online Inquiry