Mouse Anti-RPS15A Antibody (CBMOAB-40643FYC)
Cat: CBMOAB-40643FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40643FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Silkworm (Bombyx mori), Zebrafish (Danio rerio) | WB, ELISA | MO40643FC | 100 µg | ||
| CBMOAB-96513FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96513FYA | 100 µg | ||
| MO-AB-07282H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07282C | 100 µg | ||
| MO-AB-19551R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19551R | 100 µg | ||
| MO-AB-28654H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28654C | 100 µg | ||
| MO-AB-38127W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38127W | 100 µg | ||
| MO-AB-63565W | Monoclonal | Marmoset | WB, ELISA | MO63565W | 100 µg | ||
| MO-AB-70343W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70343W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Silkworm (Bombyx mori), Zebrafish (Danio rerio) |
| Clone | MO40643FC |
| Specificity | This antibody binds to Arabidopsis RPS15A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Vacuole; Cytosol; Other locations; Plasma Membrane; Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S8P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis RPS15A Antibody is a mouse antibody against RPS15A. It can be used for RPS15A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Ribosomal Protein S15a; Small Ribosomal Subunit Protein US8; Up-Regulated By HBV X Protein; 40S Ribosomal Protein S15a; S15a |
| UniProt ID | Q08112 |
| Protein Refseq | The length of the protein is 152 amino acids long. The sequence is show below: MADVEPEVAAAGVPKKRTFKKFAFKGVDLDALLDMSTDDLVKLFSSRIRRRFSRGLTRKPMALIKKLRKAKREAPQGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGVGATHSSRFIPLK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry