AibGenesis™ Mouse Anti-TCP15 Antibody (CBMOAB-44871FYC)
Cat: CBMOAB-44871FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Tomato (Lycopersicon esculentum) |
| Clone | MO44871FC |
| Specificity | This antibody binds to Arabidopsis TCP15. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Transcription factor involved the regulation of plant development. Together with TCP14, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in developing leaf blade and specific floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Involved in gynoecium and silique development. Modulates the development of the different tissues of the gynoecium through its participation in auxin and cytokinin responses. Modulates the expression of the cytokinin-responsive genes ARR7 and ARR15. May repress the expression of the auxin biosynthetic genes YUC1 and YUC4 (PubMed:26303297). Acts as negative regulator of anthocyanin accumulation under high light conditions. Modulates the expression of transcription factors involved in the induction of anthocyanin biosynthesis genes (PubMed:26574599). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Arabidopsis TCP15 Antibody is a mouse antibody against TCP15. It can be used for TCP15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Transcription factor TCP15; TCP15; At1g69690 |
| UniProt ID | Q9C9L2 |
| Protein Refseq | The length of the protein is 325 amino acids long. The sequence is show below: MDPDPDHNHRPNFPLQLLDSSTSSSSTSLAIISTTSEPNSEPKKPPPKRTSTKDRHTKVEGRGRRIRMPAMCAARVFQLTRELGHKSDGETIEWLLQQAEPAVIAATGTGTIPANFTSLNISLRSSRSSLSAAHLRTTPSSYYFHSPHQSMTHHLQHQHQVRPKNESHSSSSSSSQLLDHNQMGNYLVQSTAGSLPTSQSPATAPFWSSGDNTQNLWAFNINPHHSGVVAGDVYNPNSGGSGGGSGVHLMNFAAPIALFSGQPLASGYGGGGGGGGEHSHYGVLAALNAAYRPVAETGNHNNNQQNRDGDHHHNHQEDGSTSHHS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry