Mouse Anti-Y14 Antibody (CBMOAB-46242FYC)
Cat: CBMOAB-46242FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Silkworm (Bombyx mori) |
| Clone | MO46242FC |
| Specificity | This antibody binds to Arabidopsis Y14. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytosol; Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). The MAGO-Y14 heterodimer inhibits the ATPase activity of EIF4A3, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The MAGO-Y14 heterodimer interacts with the EJC key regulator PYM leading to EJC disassembly in the cytoplasm. Can increase in vitro the expression from reporter constructs that contain leader introns required for the expression of different genes. In association with MAGO and PYM, participates in intron-mediated enhancement of gene expression (PubMed:21676911). The MAGO-Y14 heterodimer works synergistically with the NMD pathway to regulate male gametophyte development (PubMed:26867216). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Arabidopsis Y14 Antibody is a mouse antibody against Y14. It can be used for Y14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Exon junction complex protein; RNA-binding protein 8A; Y14; RBM8; At1g51510 |
| UniProt ID | F4I9J7 |
| Protein Refseq | The length of the protein is 202 amino acids long. The sequence is show below: MANIESEAVDFEPEEDDLMDEEGTAIDGADVSPRAGHPRLKSAIAGANGESAKKTKGRGFREEKDSDRQRRLSSRDFESLGSDGRPGPQRSVEGWIILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISAMNGAELLTQNVSVDWAFSSGPSGGESYRRKNSRYGRSQRSRSPRRRY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry