AibGenesis™ Mouse Anti-PGDH Antibody (MO-AB-00474W)


Cat: MO-AB-00474W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00474W Monoclonal Barrel medic (Medicago truncatula), Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00474W 100 µg
MO-AB-00782H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00782C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), Arabidopsis (Arabidopsis lyrata)
CloneMO00474W
SpecificityThis antibody binds to Barrel medic PGDH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Barrel medic PGDH Antibody is a mouse antibody against PGDH. It can be used for PGDH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphogluconate dehydrogenase; PGDH
UniProt IDB6RPS3
Protein RefseqThe length of the protein is 152 amino acids long.
The sequence is show below: KVFKSGGFGDILTDQQVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLELGELARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIERQTAWRRVVSLAVNSGISLPGMSASLAYFDSYRRERLPANLVQAQRDY.
For Research Use Only | Not For Clinical Use.
Online Inquiry