AibGenesis™ Mouse Anti-PRK Antibody (MO-AB-00497W)


Cat: MO-AB-00497W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00497W Monoclonal Barrel medic (Medicago truncatula), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Arabidopsis, Rice, Sugar beet (Beta vulgaris) WB, ELISA MO00497W 100 µg
MOFAB-227W Arabidopsis, Rice WB 100 µg
MO-AB-00835H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00835C 100 µg
MO-AB-30480H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30480C 100 µg
MO-DKB-01755W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Arabidopsis, Rice, Sugar beet (Beta vulgaris)
CloneMO00497W
SpecificityThis antibody binds to Barrel medic PRK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Barrel medic PRK Antibody is a mouse antibody against PRK. It can be used for PRK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSer / Thr protein kinase; PRK
UniProt IDA5XEM0
Protein RefseqThe length of the protein is 418 amino acids long.
The sequence is show below: MEWHQISVSALSNLTHIDLHNNSLTSPLPCLSNSVMLETLYLGHNNFTSMLDFCFVWTNSLRTFNLSNNLNLVPWVIPLGLIDSSLLHTLDLEATNIIDSLESGMFDWYPSLHTVFLSNNITRPLPLSLGQIISQQLGGGQNETASSHGGPSKARLTPVWIVCIGGSSKKTMKSTDYNAEDFIQSYNMSVPIKHYRYAEVKRMTNSFRDKLGQGGYGVVYKASLPDGRQVAVKVIKESKGNGEEFINEVASISRTSHFGLAQICQRKDSIVSILGTRGTIGYIAPEVFSRTFGGVSHKSDVYSYGMLILEMIGGRKNYDTGGSCTSEMYFSDWIYKDLELSNNLNCSANSEEENDMARKITMISLWCIQTNPSDRPSMSKVIEMLQGPLGSVPYPPKPFLYSPERPSLQISYVSSNNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry