AibGenesis™ Mouse Anti-TIL Antibody (MO-AB-00631W)


Cat: MO-AB-00631W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00631W Monoclonal Barrel medic (Medicago truncatula), A. thaliana (Arabidopsis thaliana), Grape (Vitis vinifera), Soybean (Glycine max), Tomato (Lycopersicon esculentum) WB, ELISA MO00631W 100 µg
MO-AB-00632W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00632W 100 µg
MO-AB-00842W Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO00842W 100 µg
MO-AB-32670H Monoclonal Soybean (Glycine max) WB, ELISA MO32670C 100 µg
MO-AB-32671H Monoclonal Soybean (Glycine max) WB, ELISA MO32671C 100 µg
MO-AB-35435H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO35435C 100 µg
MO-AB-35436H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO35436C 100 µg
MO-AB-39535W Monoclonal Grape (Vitis vinifera) WB, ELISA MO39535W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), A. thaliana (Arabidopsis thaliana), Grape (Vitis vinifera), Soybean (Glycine max), Tomato (Lycopersicon esculentum)
CloneMO00631W
SpecificityThis antibody binds to Barrel medic TIL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInvolved in basal (BT) and acquired thermotolerance (AT), probably by preventing plasma membrane lipids peroxidation induced by severe heat-shock (HS) (PubMed:19302169, PubMed:23837879). Lipocalin that confers protection against oxidative stress caused by heat, freezing, paraquat and light (PubMed:18671872, PubMed:19302169). Confers resistance to high salt (NaCl) levels, probably by protecting chloroplasts from ion toxicity via ion homeostasis maintenance (PubMed:20959419, PubMed:24028869). Required for seed longevity by insuring polyunsaturated lipids integrity (PubMed:23837879). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Barrel medic TIL Antibody is a mouse antibody against TIL. It can be used for TIL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTemperature-induced lipocalin; TIL; MTR_4g131390
UniProt IDQ38JC8
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: MANKEMDVARGVDLKRYMGRWYEIACFPSRFQPSDGKNTRATYTLRDDGTVNVLNETWSGGKRSYIEGTAYKADPNSDEAKLKVKFYVPPMLPIIPVTGDYWVLHLDHDYHYALIGQPSRNYLWILCRQPHLDEEIYNELVQKAKEEGYDVSKLRKTPQSDTPPEQEGPEDTKGIWWFKSLFGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry