AibGenesis™ Mouse Anti-ZFP Antibody (MO-AB-00661W)


Cat: MO-AB-00661W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00661W Monoclonal Barrel medic (Medicago truncatula), Chicken (Gallus gallus) WB, ELISA MO00661W 100 µg
MO-AB-04866Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04866Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), Chicken (Gallus gallus)
CloneMO00661W
SpecificityThis antibody binds to Barrel medic ZFP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Barrel medic ZFP Antibody is a mouse antibody against ZFP. It can be used for ZFP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC3HC4 zinc finger containing protein; E3 ubiquitin ligase; ZFP; MTR_8g020850
UniProt IDQ4VYC9
Protein RefseqThe length of the protein is 383 amino acids long.
The sequence is show below: MSSQEQALVSLLSQLALSFDGAVLGFAVAYVAVRSIRKFTLTSAALRKITAAPSVSVSDLRSLLTETDENSDEGKIVIVRGTVDAKNVVDGSWKALWPGVLVSSESGDKGVVLQRTQTCIYNEWKGLFGWTSDLRALFLRSWRQQESTSLRKIPFVLIDVGRPSNPEYVVVNMDGSSHPLPLTTVYHRLQPVNPPPYTFLQALFGHEYPVGLLDEEKILPLGKDVSAVGLCSLRNGIAEIKACNDLPYYLSDLSKDQMIVDLSFKTKLLFWSGILLGSMSVGIIGYAVVRNWNKWKQWKQQRQLQQRRQQPIEPVPPTDDEIEDVPDGQLCVICLMRRRRSVFIPCGHLVCCQGCAISVESEVAPKCPVCRQEVRDSVRIFES.
For Research Use Only | Not For Clinical Use.
Online Inquiry