Mouse Anti-CDK7 Antibody (CBMOAB-01204HCB)
Cat: CBMOAB-01204HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-01204HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), D. melanogaster (Drosophila melanogaster), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO01204HB | 100 µg | ||
CBMOAB-03286FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO03286FYA | 100 µg | ||
CBMOAB-69923FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO69923FYA | 100 µg | ||
MO-AB-09983R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09983R | 100 µg | ||
MO-AB-12560W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12560W | 100 µg | ||
MO-AB-24532R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24532R | 100 µg | ||
MO-AB-44018W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44018W | 100 µg | ||
MO-AB-52726W | Monoclonal | Marmoset | WB, ELISA | MO52726W | 100 µg | ||
MO-NAB-00624W | Monoclonal | D. melanogaster (Drosophila melanogaster) | IP, WB | NW0546 | 100 µg | ||
MO-DKB-01228W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB, IHC, IHC-P | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), D. melanogaster (Drosophila melanogaster), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) |
Clone | MO01204HB |
Specificity | This antibody binds to C. elegans CDK7. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CDK7 (Cyclin Dependent Kinase 7) is a Protein Coding gene. Diseases associated with CDK7 include Breast Cancer and Hemophagocytic Lymphohistiocytosis, Familial, 3. Among its related pathways are RNA Polymerase II Transcription Initiation And Promoter Clearance and Formation of HIV elongation complex in the absence of HIV Tat. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDK20. |
Product Overview | Mouse Anti-C. elegans CDK7 Antibody is a mouse antibody against CDK7. It can be used for CDK7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cyclin-dependent kinase 7 homolog; Protein CDK-7; cdk-7 |
UniProt ID | G5EFV5 |
Protein Refseq | The length of the protein is 330 amino acids long. The sequence is show below: MSRRYDTIKHLGEGQFANVYLAQDLESGECVAIKKIKLGSREEAKDGINRTAIREIKLLKEIHHDNIIGLRDVIGHRTSIQLVFDFMDTDLEHVIKDKEIILMPAHIKNITMQMLLGLEFLHVHWILHRDLKPNNLLMNKMGRVKLTDFGLARFFGSPNRNYTHQVVTRWYRAPELLFGARSYGVGIDIWSVGCIIAELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEMNSYVIIKPQTEYMALNYYFSAAPQDLLDLMAGMWTFDPIKRLTCTQSLQMEYFRTQPFCCLDEELPLPKKQQPQKRSRRLDDDGTRPVRRLNFD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry