Mouse Anti-CDK7 Antibody (CBMOAB-01204HCB)


Cat: CBMOAB-01204HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-01204HCB Monoclonal C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), D. melanogaster (Drosophila melanogaster), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO01204HB 100 µg
CBMOAB-03286FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO03286FYA 100 µg
CBMOAB-69923FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69923FYA 100 µg
MO-AB-09983R Monoclonal Cattle (Bos taurus) WB, ELISA MO09983R 100 µg
MO-AB-12560W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12560W 100 µg
MO-AB-24532R Monoclonal Pig (Sus scrofa) WB, ELISA MO24532R 100 µg
MO-AB-44018W Monoclonal Horse (Equus caballus) WB, ELISA MO44018W 100 µg
MO-AB-52726W Monoclonal Marmoset WB, ELISA MO52726W 100 µg
MO-NAB-00624W Monoclonal D. melanogaster (Drosophila melanogaster) IP, WB NW0546 100 µg
MO-DKB-01228W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), D. melanogaster (Drosophila melanogaster), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO01204HB
SpecificityThis antibody binds to C. elegans CDK7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCDK7 (Cyclin Dependent Kinase 7) is a Protein Coding gene. Diseases associated with CDK7 include Breast Cancer and Hemophagocytic Lymphohistiocytosis, Familial, 3. Among its related pathways are RNA Polymerase II Transcription Initiation And Promoter Clearance and Formation of HIV elongation complex in the absence of HIV Tat. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDK20.
Product OverviewMouse Anti-C. elegans CDK7 Antibody is a mouse antibody against CDK7. It can be used for CDK7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclin-dependent kinase 7 homolog; Protein CDK-7; cdk-7
UniProt IDG5EFV5
Protein RefseqThe length of the protein is 330 amino acids long. The sequence is show below: MSRRYDTIKHLGEGQFANVYLAQDLESGECVAIKKIKLGSREEAKDGINRTAIREIKLLKEIHHDNIIGLRDVIGHRTSIQLVFDFMDTDLEHVIKDKEIILMPAHIKNITMQMLLGLEFLHVHWILHRDLKPNNLLMNKMGRVKLTDFGLARFFGSPNRNYTHQVVTRWYRAPELLFGARSYGVGIDIWSVGCIIAELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEMNSYVIIKPQTEYMALNYYFSAAPQDLLDLMAGMWTFDPIKRLTCTQSLQMEYFRTQPFCCLDEELPLPKKQQPQKRSRRLDDDGTRPVRRLNFD.
For Research Use Only | Not For Clinical Use.
Online Inquiry