Mouse Anti-IFNA14 Antibody (MO-AB-07987W)


Cat: MO-AB-07987W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07987W Monoclonal Cat (Felis catus), Pig (Sus scrofa) WB, ELISA MO07987W 100 µg
MO-AB-26494R Monoclonal Pig (Sus scrofa) WB, ELISA MO26494R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Pig (Sus scrofa)
CloneMO07987W
SpecificityThis antibody binds to Cat IFNA14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat IFNA14 Antibody is a mouse antibody against IFNA14. It can be used for IFNA14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterferon alpha 14; IFNA14
UniProt IDQ863I5
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFAFPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTGASSSAAWNTTLLEEFCTGLDRQLTRLEACVVQEVGEGEAPLTNEDSTLRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYSSTALQKRLRSEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry