AibGenesis™ Mouse Anti-IFNA5 Antibody (MO-AB-07988W)


Cat: MO-AB-07988W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07988W Monoclonal Cat (Felis catus), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO07988W 100 µg
MO-AB-26441H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26441C 100 µg
MO-AB-26501R Monoclonal Pig (Sus scrofa) WB, ELISA MO26501R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO07988W
SpecificityThis antibody binds to Cat IFNA5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat IFNA5 Antibody is a mouse antibody against IFNA5. It can be used for IFNA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterferon alpha 5; IFNA5
UniProt IDQ8MIL6
Protein RefseqThe length of the protein is 194 amino acids long.
The sequence is show below: MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRSDFAFPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRLEACVVQEVGEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYYSSTALQKRLRSEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry