AibGenesis™ Mouse Anti-IL-29 Antibody (MO-AB-08105W)


Cat: MO-AB-08105W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08105W Monoclonal Cat (Felis catus), Dog (Canis lupus familiaris) WB, ELISA MO08105W 100 µg
MO-AB-31284W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31284W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Dog (Canis lupus familiaris)
CloneMO08105W
SpecificityThis antibody binds to Cat IL-29.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat IL-29 Antibody is a mouse antibody against IL-29. It can be used for IL-29 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin 29; IL-29
UniProt IDQ1JUL2
Protein RefseqThe length of the protein is 190 amino acids long.
The sequence is show below: MATARVLVLVTVVLGLTSAGPVPTSRPPPTRRGCHVGKFPSLSPRELEAFKKARDALEESLPLKNWSCGSRLFPRTRDLIRLQAWERPAALEAELDLTLKVLGNMTDSSLGVVLDQPLRVVRHIHSELQACVRAQPTAGPRPRGRLHHWLHRLQRPPEESQGCLEASVTFNLFRLLTRDLKCVTGGDLCV.
For Research Use Only | Not For Clinical Use.
Online Inquiry