AibGenesis™ Mouse Anti-OR13F1 Antibody (MO-AB-08396W)


Cat: MO-AB-08396W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08396W Monoclonal Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Gorilla, Rabbit (Oryctolagus cuniculus) WB, ELISA MO08396W 100 µg
MO-AB-09094Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09094Y 100 µg
MO-AB-17196W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17196W 100 µg
MO-AB-17200R Monoclonal Cattle (Bos taurus) WB, ELISA MO17200R 100 µg
MO-AB-32415W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32415W 100 µg
MO-AB-38647W Monoclonal Gorilla WB, ELISA MO38647W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Gorilla, Rabbit (Oryctolagus cuniculus)
CloneMO08396W
SpecificityThis antibody binds to Cat OR13F1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Cat OR13F1 Antibody is a mouse antibody against OR13F1. It can be used for OR13F1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; LOC101080583
UniProt IDM3WTI4
Protein RefseqThe length of the protein is 319 amino acids long.
The sequence is show below: MFQGNLTSVTVFFLLGFSHYPKVEVIVFVLCLLMYLITLLGNIILISITILDSHLHKPMYFFLSNLSFLDIWYTSSAFTPMLTNFVTGENTISFVGCVAQMYFSLAMGATECVLLSLMAYDRYVAICNPLRYPIIMNRKVCLQIAAGSWLTGYLTTLVETIFVLQLSLCGHNTINHFACEILAVLKLVCVDTSMVELLMLVITTLILPMPVLLICISYAFILSNILRIRSVGGRSKAFSTCAAHLTVVVLFFGTALSMYLKPSAVDSQEIDKFIALVYGGLTPMLNPIIYSLRNKEVKAAMKRLLIRNPFGTVLISVLN.
For Research Use Only | Not For Clinical Use.
Online Inquiry