AibGenesis™ Mouse Anti-OR4K13 Antibody (MO-AB-08357W)


Cat: MO-AB-08357W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08357W Monoclonal Cat (Felis catus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Sheep (Ovis aries) WB, ELISA MO08357W 100 µg
MO-AB-16507Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16507Y 100 µg
MO-AB-16677W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16677W 100 µg
MO-AB-45884W Monoclonal Horse (Equus caballus) WB, ELISA MO45884W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Sheep (Ovis aries)
CloneMO08357W
SpecificityThis antibody binds to Cat OR4K13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Cat OR4K13 Antibody is a mouse antibody against OR4K13. It can be used for OR4K13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR4K13
UniProt IDM3W1Z5
Protein RefseqThe length of the protein is 304 amino acids long.
The sequence is show below: MERVNHSVVSEFILLGLSKSQNLQILFFLGFSVVYAGIVLGNLLILVTVTFDSRLHTPMYFLLINLSCIDMILASFATPKMIVDFLRKRKTISWWGCYSQMFFMHLLGGSEMMLLVAMAIDRYVAICKPLHYMSIMNPRVLGGLLLSSYTVGFVHSSSQMAFMLNLPFCGPNVVDSFFCDLPLVIKLACKDTYMLQLLVIADSGLLSLVCFLLLLVSYTVIIHSVRHRAASGSAKAFSTLSAHITVVTLFFAPCVFIYVWPFSRYSVDKILSVFYTIFTPLLNPIIYTLRNQEVKAAIKFKFCI.
For Research Use Only | Not For Clinical Use.
Online Inquiry