AibGenesis™ Mouse Anti-OR4K15 Antibody (MO-AB-08789W)


Cat: MO-AB-08789W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08789W Monoclonal Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO08789W 100 µg
MO-AB-09129Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09129Y 100 µg
MO-AB-16509Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16509Y 100 µg
MO-AB-17252R Monoclonal Cattle (Bos taurus) WB, ELISA MO17252R 100 µg
MO-AB-20380W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20380W 100 µg
MO-AB-45886W Monoclonal Horse (Equus caballus) WB, ELISA MO45886W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO08789W
SpecificityThis antibody binds to Cat OR4K15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Cat OR4K15 Antibody is a mouse antibody against OR4K15. It can be used for OR4K15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR4K15
UniProt IDM3VXP2
Protein RefseqThe length of the protein is 324 amino acids long.
The sequence is show below: MNETNHSRVTEFVLLGLSNSQELQPFLFVIFSLLYLAILLGNFLIILTVTSDSHLHTPMYFLLANLSFVDICVASFATPKMIADFLVEQKTISFDACLAQIFFVHLFTGSEMVLLVSMAYDRYVAICKPLHYMTIMSRRVCIILVLISWLVGFIHTTSQLAFTINLPFCGPNQVDSFFCDLPLVTKLACIDTYVVSLLIVADSGFLSMSSFLLLVVSYTVILITVRKRSSASMAKARSTLTAHITVVTLFFGPCIFIYVWPFSSYSVDKVLAVFYTIFTPILNPIIYTLRNKEVKAAMLKLKSRYLKSGQVSAAIRNVLFLETK.
For Research Use Only | Not For Clinical Use.
Online Inquiry