Mouse Anti-OR5AP2 Antibody (MO-AB-09018W)


Cat: MO-AB-09018W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09018W Monoclonal Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Marmoset WB, ELISA MO09018W 100 µg
MO-AB-10087W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10087W 100 µg
MO-AB-32543W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32543W 100 µg
MO-AB-35303W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35303W 100 µg
MO-AB-60710W Monoclonal Marmoset WB, ELISA MO60710W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Marmoset
CloneMO09018W
SpecificityThis antibody binds to Cat OR5AP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Cat OR5AP2 Antibody is a mouse antibody against OR5AP2. It can be used for OR5AP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR5AP2
UniProt IDM3WTF5
Protein RefseqThe length of the protein is 317 amino acids long.
The sequence is show below: MRRYMKEVQGRNQTEVTEFILLGLSDNSDLQSVLFGLFLLIYMATMVGNLGMMVLIKMDPCLHTPMYLFLSSLSFVDASYSSSVTPKMLVNLVAENKAISFNGCAAQFYFFGSFLGTECFLLAMMAYDRYAAIWNPLLYSVLMSGRICFLLVAMSFLAGFGNAAIHTGMTFRLSFCGSNRINHFYCDTPPLLKLSCSDTRINGIVIMVFSSFNVITCVMVVLISYLCILIAILRIPSLEGRHKAFSTCASHLMAVTIFFGTILFMYLRPTSSYSMEQEKIVSVFYTVVIPMLNPLIYSLKNKDVKGALKKILQKHML.
For Research Use Only | Not For Clinical Use.
Online Inquiry