AibGenesis™ Mouse Anti-SHISAL2A Antibody (MO-AB-09681W)


Cat: MO-AB-09681W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09681W Monoclonal Cat (Felis catus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09681W 100 µg
MO-AB-28975H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28975C 100 µg
MO-AB-64359W Monoclonal Marmoset WB, ELISA MO64359W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Marmoset, Rat (Rattus norvegicus)
CloneMO09681W
SpecificityThis antibody binds to Cat SHISAL2A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat SHISAL2A Antibody is a mouse antibody against SHISAL2A. It can be used for SHISAL2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione peroxidase; GPX7
UniProt IDM3WFD9
Protein RefseqThe length of the protein is 187 amino acids long.
The sequence is show below: VMVGALVLAWLLLSAAACAQREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYGVSFPMFSKVAVTGTGAHPAFKYLIQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEIRPQITALVRKLILKKREDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry