Mouse Anti-TNP2 Antibody (MO-AB-08233W)


Cat: MO-AB-08233W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08233W Monoclonal Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO08233W 100 µg
MO-AB-15441W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15441W 100 µg
MO-AB-18031Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18031Y 100 µg
MO-AB-22007R Monoclonal Cattle (Bos taurus) WB, ELISA MO22007R 100 µg
MO-AB-29682H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29682C 100 µg
MO-AB-30833R Monoclonal Pig (Sus scrofa) WB, ELISA MO30833R 100 µg
MO-AB-33791W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33791W 100 µg
MO-AB-35865W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35865W 100 µg
MO-AB-46880W Monoclonal Horse (Equus caballus) WB, ELISA MO46880W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO08233W
SpecificityThis antibody binds to Cat TNP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays a key role in the replacement of histones to protamine in the elongating spermatids of mammals. In condensing spermatids, loaded onto the nucleosomes, where it promotes the recruitment and processing of protamines, which are responsible for histone eviction. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Cat TNP2 Antibody is a mouse antibody against TNP2. It can be used for TNP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNuclear transition protein 2; Tnp2; TNP2
UniProt IDB3LF33
Protein RefseqThe length of the protein is 119 amino acids long.
The sequence is show below: MDTKTQSLPVTHTQPHSNSRPQSHTCSQCCDRSRSRSRSRSSGHSPTGHQNQSPDPSPPPRHQKHSMRSHHCPPRPTTRSCSYPKNRRNSGGKVKKRKAAKRSPQVYKTKRRNSGRKYN.
For Research Use Only | Not For Clinical Use.
Online Inquiry