AibGenesis™ Mouse Anti-ACVRL1 Antibody (MO-AB-06977R)


Cat: MO-AB-06977R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06977R Monoclonal Cattle (Bos taurus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO06977R 100 µg
CBMOAB-35058FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO35058FYA 100 µg
CBMOAB-64834FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64834FYA 100 µg
MO-AB-09629W Monoclonal Cat (Felis catus) WB, ELISA MO09629W 100 µg
MO-AB-25429W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25429W 100 µg
MO-AB-23520R Monoclonal Pig (Sus scrofa) WB, ELISA MO23520R 100 µg
MO-AB-14087Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14087Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO06977R
SpecificityThis antibody binds to Cattle ACVRL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. (From NCBI)
Product OverviewMouse Anti-Cattle ACVRL1 Antibody is a mouse antibody against ACVRL1. It can be used for ACVRL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACVRL1 protein; ACVRL1
UniProt IDA4FUX2
Protein RefseqThe length of the protein is 503 amino acids long.
The sequence is show below: MTLNLPRRRLLMLLIALGLTQGDPLKPSRGPLVTCTCENPHCKGPTCQGSWCTVVLVWEDGHLREYRGCGNMHPEVCRARPTEFVNHYCCYSPLCNHNVSLTLEATQTAPEQPQGDGQLPLILGPVLAFLVLVALGALGLWHVRRRKEKQRGANSELGESSLILKPSEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDN.
See other products for " ACVRL1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry