AibGenesis™ Mouse Anti-ACVRL1 Antibody (MO-AB-06977R)
Cat: MO-AB-06977R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-06977R | Monoclonal | Cattle (Bos taurus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO06977R | 100 µg | ||
| CBMOAB-35058FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO35058FYA | 100 µg | ||
| CBMOAB-64834FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64834FYA | 100 µg | ||
| MO-AB-09629W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09629W | 100 µg | ||
| MO-AB-25429W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25429W | 100 µg | ||
| MO-AB-23520R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23520R | 100 µg | ||
| MO-AB-14087Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14087Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO06977R |
| Specificity | This antibody binds to Cattle ACVRL1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. (From NCBI) |
| Product Overview | Mouse Anti-Cattle ACVRL1 Antibody is a mouse antibody against ACVRL1. It can be used for ACVRL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ACVRL1 protein; ACVRL1 |
| UniProt ID | A4FUX2 |
| Protein Refseq | The length of the protein is 503 amino acids long. The sequence is show below: MTLNLPRRRLLMLLIALGLTQGDPLKPSRGPLVTCTCENPHCKGPTCQGSWCTVVLVWEDGHLREYRGCGNMHPEVCRARPTEFVNHYCCYSPLCNHNVSLTLEATQTAPEQPQGDGQLPLILGPVLAFLVLVALGALGLWHVRRRKEKQRGANSELGESSLILKPSEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDN. |
See other products for " ACVRL1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry