Mouse Anti-Cattle ACVRL1 Antibody (MO-AB-06977R)


Cat: MO-AB-06977R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06977R
SpecificityThis antibody binds to Cattle ACVRL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2.
Product OverviewMouse Anti-Cattle ACVRL1 Antibody is a mouse antibody against ACVRL1. It can be used for ACVRL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACVRL1 protein; ACVRL1
UniProt IDA4FUX2
Protein RefseqThe length of the protein is 503 amino acids long.
The sequence is show below: MTLNLPRRRLLMLLIALGLTQGDPLKPSRGPLVTCTCENPHCKGPTCQGSWCTVVLVWEDGHLREYRGCGNMHPEVCRARPTEFVNHYCCYSPLCNHNVSLTLEATQTAPEQPQGDGQLPLILGPVLAFLVLVALGALGLWHVRRRKEKQRGANSELGESSLILKPSEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDN.
For Research Use Only | Not For Clinical Use.
Online Inquiry