Mouse Anti-ALLC Antibody (MO-AB-07265R)


Cat: MO-AB-07265R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07265R Monoclonal Cattle (Bos taurus), A. aegpti (Aedes aegpti), E. coli (Escherichia coli ) WB, ELISA MO07265R 100 µg
CBMOAB-0081YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO0081YC 100 µg
MO-AB-04915Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO04915Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), A. aegpti (Aedes aegpti), E. coli (Escherichia coli )
CloneMO07265R
SpecificityThis antibody binds to Cattle ALLC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInvolved in the anaerobic nitrogen utilization via the assimilation of allantoin (PubMed:10601204, PubMed:20038185). Catalyzes specifically the hydrolysis of allantoate to yield CO2, NH3 and S-ureidoglycine, which is unstable and readily undergoes a second deamination by S-ureidoglycine aminohydrolase AllE to yield S-ureidoglycolate and NH3 (PubMed:20038185). In vivo, the spontaneous release of S-ureidoglycolate and ammonia from S-ureidoglycine appears to be too slow to sustain an efficient flux of nitrogen (PubMed:20038185).
Product OverviewMouse Anti-Cattle ALLC Antibody is a mouse antibody against ALLC. It can be used for ALLC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProbable allantoicase; ALLC
UniProt IDG3N0Y5
Protein RefseqThe length of the protein is 417 amino acids long.
The sequence is show below: MADSPREGKVARPPDFTQLIDLASEFVGGKILFATDDFFAPAENLLKRDNPSFKEHEYTEFGKWMDGWQTRRKRIPGHDWCVVQLGIQGVIRGFDVDTSYFTGDHAPRVSIQAANFEEDKQPEIPQREVRTGAAATPEEFEAISELKSDDWSCLVPMTELTLGVLCTNNPYFATNTSTAWFHLLFKIYQWQLFPDGGIARLRVYGTGQKDWTAGDPKEPLDLVTVAYGGACVGFSNAHFGHPNNLIGVGTATSMA.
See other products for " allc "
For Research Use Only | Not For Clinical Use.
Online Inquiry