AibGenesis™ Mouse Anti-APOBEC3Z3 Antibody (MO-AB-07494R)


Cat: MO-AB-07494R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07494R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO07494R 100 µg
MO-AB-14219Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14219Y 100 µg
MO-AB-23818R Monoclonal Pig (Sus scrofa) WB, ELISA MO23818R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO07494R
SpecificityThis antibody binds to Cattle APOBEC3Z3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle APOBEC3Z3 Antibody is a mouse antibody against APOBEC3Z3. It can be used for APOBEC3Z3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPOBEC3Z3; APOBEC3Z3; APOBEC3B
UniProt IDB7T155
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MTEGWAGSGHPGQGACVWTPGTRNTMNLLREVLFKQQFGNQPRVPAPYYRRKTYLCYQLKQRNDLTLDRGCFRNKKQRHAEIRFIDKINSLDLNPSQSYKIICYITWSPCPNCANELVNFITRNNHLKLEIFASRLYFHWIKSFKMGLQDLQNAGISVAVMTHTEFEDCWEQFVDNQSRPFQPWDKLEQYSASIRRRLQRILTAPI.
For Research Use Only | Not For Clinical Use.
Online Inquiry