AibGenesis™ Mouse Anti-CCDC70 Antibody (MO-AB-09656R)


Cat: MO-AB-09656R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09656R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO09656R 100 µg
MO-AB-24567H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24567C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO09656R
SpecificityThis antibody binds to Cattle CCDC70.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CCDC70 Antibody is a mouse antibody against CCDC70. It can be used for CCDC70 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain-containing protein 70; CCDC70
UniProt IDQ0II65
Protein RefseqThe length of the protein is 222 amino acids long.
The sequence is show below: MFPFKVRKWMGLACFRSLVVSSSSIRQKKLIHKLQEEKAFREEMRHFREKIEDFREEMWNFRSKMRAFRGEILGFWEEDRLFWEEEKTFWKEEKAFWEMEKSFREEEKAFWKKYRIFWKEDRAFWKEDNALWERDRNLLQEDKALWEEEKALWVEERALLEEEKVLWEDKKTLWEEENALWEEEKAAWVEGVVPVVEQQVLEGGHHHVSGRPRSPASSRGRA.
For Research Use Only | Not For Clinical Use.
Online Inquiry