Mouse Anti-Cattle COX11 Antibody (MO-AB-10612R)


Cat: MO-AB-10612R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10612R
SpecificityThis antibody binds to Cattle COX11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX11 (COX11, Cytochrome C Oxidase Copper Chaperone) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. Gene Ontology (GO) annotations related to this gene include electron transfer activity and cytochrome-c oxidase activity.
Product OverviewMouse Anti-Cattle COX11 Antibody is a mouse antibody against COX11. It can be used for COX11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase assembly protein COX11, mitochondrial; COX11
UniProt IDA3KMZ6
Protein RefseqThe length of the protein is 282 amino acids long.
The sequence is show below: MGGLWRPAWRRVVFCGWSWSHLGRPTRAAERAEPCLRPGRSGPAGTEQGLRRLGTWRRPSPAEQPARRPKSTNPYTRSQEEDWRRRNKTVLTYMAAAAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDQIENMVPVKDRIIKITFNADVHASLQWNFRPQQTEIYVVPGETALAFYKAKNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMVNVDLITLSYT.
See other products for " COX11 "
MO-AB-53447WMouse Anti-Marmoset COX11 Antibody (MO-AB-53447W)
CBMOAB-26450FYCMouse Anti-Arabidopsis COX11 Antibody (CBMOAB-26450FYC)
MO-AB-24997HMouse Anti-Rat Cox11 Antibody (MO-AB-24997H)
CBMOAB-00813CRMouse Anti-Yeast COX11 Antibody (CBMOAB-00813CR)
CBMOAB-71379FYAMouse Anti-Zebrafish cox11 Antibody (CBMOAB-71379FYA)
MO-AB-17711WMouse Anti-Chimpanzee COX11 Antibody (MO-AB-17711W)
CBMOAB-02105HCBMouse Anti-C. elegans COX11 Antibody (CBMOAB-02105HCB)
CBMOAB-39752FYAMouse Anti-Rhesus COX11 Antibody (CBMOAB-39752FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry