AibGenesis™ Mouse Anti-COX11 Antibody (MO-AB-10612R)


Cat: MO-AB-10612R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10612R Monoclonal Cattle (Bos taurus), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast WB, ELISA MO10612R 100 µg
CBMOAB-26450FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO26450FC 100 µg
CBMOAB-39752FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO39752FYA 100 µg
CBMOAB-00813CR Monoclonal Yeast WB, ELISA MO00813CR 100 µg
CBMOAB-02105HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO02105HB 100 µg
MO-AB-17711W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17711W 100 µg
MO-AB-53447W Monoclonal Marmoset WB, ELISA MO53447W 100 µg
MO-AB-24997H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24997C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast
CloneMO10612R
SpecificityThis antibody binds to Cattle COX11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle COX11 Antibody is a mouse antibody against COX11. It can be used for COX11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase assembly protein COX11, mitochondrial; COX11
UniProt IDA3KMZ6
Protein RefseqThe length of the protein is 282 amino acids long.
The sequence is show below: MGGLWRPAWRRVVFCGWSWSHLGRPTRAAERAEPCLRPGRSGPAGTEQGLRRLGTWRRPSPAEQPARRPKSTNPYTRSQEEDWRRRNKTVLTYMAAAAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDQIENMVPVKDRIIKITFNADVHASLQWNFRPQQTEIYVVPGETALAFYKAKNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMVNVDLITLSYT.
See other products for " cox11 "
For Research Use Only | Not For Clinical Use.
Online Inquiry