AibGenesis™ Mouse Anti-CRCT1 Antibody (MO-AB-10714R)


Cat: MO-AB-10714R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10714R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO10714R 100 µg
MO-AB-25058H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25058C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO10714R
SpecificityThis antibody binds to Cattle CRCT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CRCT1 Antibody is a mouse antibody against CRCT1. It can be used for CRCT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCysteine-rich C-terminal 1; CRCT1
UniProt IDQ0II20
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: MSSQQSAKGSPRGSSQGPTPCPAPCPAPEPDTSSCSSGCCGNGCCGNGCCGSSGDSGCCGDCGCGDCGCGGSSSVGCCCFPRRRRRQGRRGCGCCGGSSQRSQYSSSSGCCGC.
For Research Use Only | Not For Clinical Use.
Online Inquiry