AibGenesis™ Mouse Anti-DBIL5 Antibody (MO-AB-11193R)


Cat: MO-AB-11193R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11193R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO11193R 100 µg
MO-AB-25283H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25283C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO11193R
SpecificityThis antibody binds to Cattle DBIL5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle DBIL5 Antibody is a mouse antibody against DBIL5. It can be used for DBIL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDiazepam-binding inhibitor-like 5; Endozepine-like peptide; ELP; DBIL5
UniProt IDQ9MZG3
Protein RefseqThe length of the protein is 87 amino acids long.
The sequence is show below: MCQVEFEMACAAIKQLKGPVSDQEKLLVYSYYKQATQGDCNIPAPPATDLKAKAKWEAWNENKGMSKMDAMRIYIAKVEELKKNEAG.
For Research Use Only | Not For Clinical Use.
Online Inquiry