Mouse Anti-ECD Antibody (MO-AB-11792R)


Cat: MO-AB-11792R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11792R Monoclonal Cattle (Bos taurus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO11792R 100 µg
CBMOAB-15527FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO15527FYA 100 µg
CBMOAB-41419FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO41419FYA 100 µg
CBMOAB-74366FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74366FYA 100 µg
MO-AB-01982W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01982W 100 µg
MO-AB-37158W Monoclonal Goat (Capra hircus) WB, ELISA MO37158W 100 µg
MO-AB-54660W Monoclonal Marmoset WB, ELISA MO54660W 100 µg
MO-AB-03167H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03167C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO11792R
SpecificityThis antibody binds to Cattle ECD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired in both the follicle cells and the germline for oocyte development.
Product OverviewMouse Anti-Cattle ECD Antibody is a mouse antibody against ECD. It can be used for ECD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEcdysoneless homolog; Drosophila; Suppressor of S. cerevisiae gcr2; ECD
UniProt IDQ2KI67
Protein RefseqThe length of the protein is 642 amino acids long.
The sequence is show below: MEENMKFATVEDTVEYRLFLIPDKPGDPEEHREILQKCIERIMTQFAPMLVPYIWQNQPFNLKYKPGKGDVPAHIFGMTKFGDNIEDEWFIVYIVKQITKEFPELVARIEDNDGEFLLIEAADFLPKWLDPDNSANRVFFHQGELCIIPAPKKSGTVSWLPTTPPTISQALSIISTHPEKILASESVRAAVNRRIRGYPEKIKASLHQAHCFLPAGIAAVLKQCPRLVAAGVQAFYLRDPIDLRACRIFKTFLPE.
See other products for " ECD "
For Research Use Only | Not For Clinical Use.
Online Inquiry