Mouse Anti-EVI2A Antibody (MO-AB-12172R)


Cat: MO-AB-12172R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12172R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO12172R 100 µg
MO-AB-25686H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25686C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO12172R
SpecificityThis antibody binds to Cattle EVI2A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle EVI2A Antibody is a mouse antibody against EVI2A. It can be used for EVI2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEcotropic viral integration site 2A; EVI2A
UniProt IDQ3ZBJ7
Protein RefseqThe length of the protein is 232 amino acids long.
The sequence is show below: MGHMRHYLHLAFLMTTAFSLSPGTKANYTHLWDNNSTVLDPDIHNKTDRSQNENFNANPKTPEADKKDNSTNMPETETSSHITFLTPKSELELYVSSVVRNSPPTVQNIENTSKSHSEIFKKGVCEEDNNKMAMLVCLIIIAVLFLICTILFLSTVVLANKVSSLRRSKQAGKRQPRSNGDFLASSGLWPAESDTWKRAKQLTVPNLMMQSTGVLTATMERKDEEGTEKLTN.
For Research Use Only | Not For Clinical Use.
Online Inquiry