AibGenesis™ Mouse Anti-GPCR142 Antibody (MO-AB-13253R)


Cat: MO-AB-13253R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13253R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO13253R 100 µg
MO-AB-26183R Monoclonal Pig (Sus scrofa) WB, ELISA MO26183R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa)
CloneMO13253R
SpecificityThis antibody binds to Cattle GPCR142.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle GPCR142 Antibody is a mouse antibody against GPCR142. It can be used for GPCR142 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRelaxin-3/INSL7 receptor 2; GPCR142
UniProt IDQ5Y983
Protein RefseqThe length of the protein is 373 amino acids long.
The sequence is show below: MPTPNTSAPLPAFWVNASGGSVLSAADATMPVGFLALRVSVALAYGLVGAVGLLGNSAVLWVLGNCAQRAPCPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNIYASIFLITALSVARYWVVAMAAGPGTHLSLFWARVATLAMWVAASLVTVPTAVFGAEGEVSGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLSIITTSYLLLLAFLRRRRRRWRDSRGVAHSIRILLASFF.
For Research Use Only | Not For Clinical Use.
Online Inquiry