AibGenesis™ Mouse Anti-IQCF1 Antibody (MO-AB-14252R)


Cat: MO-AB-14252R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14252R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO14252R 100 µg
MO-AB-26552H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26552C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO14252R
SpecificityThis antibody binds to Cattle IQCF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle IQCF1 Antibody is a mouse antibody against IQCF1. It can be used for IQCF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIQ domain-containing protein F1; IQCF1
UniProt IDQ3SYS7
Protein RefseqThe length of the protein is 209 amino acids long.
The sequence is show below: METDQPKTVDENTENKPQENKGLVENSLPSEPSPTLEKAEAQQENKAATKGADDADKRSGVVTKPQKKPPVSDPEAVKIQAWWRGTLVRRTLLHAALRVWIIQAWWRVKLARLQDSRRRAALENFTRKEWAAVRLQSWVRMWRIRRRYCRLLDAARIIQAYWRCHSCTSRGFIKGYYRVTANQLHLELEILLGSGPCIVTECIPLPIKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry