AibGenesis™ Mouse Anti-KRTAP3-3 Antibody (MO-AB-14761R)


Cat: MO-AB-14761R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14761R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO14761R 100 µg
Inquiry
MO-AB-26718H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26718C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO14761R
SpecificityThis antibody binds to Cattle KRTAP3-3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIn the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Cattle KRTAP3-3 Antibody is a mouse antibody against KRTAP3-3. It can be used for KRTAP3-3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKeratin-associated protein 3-3; KRTAP3-3
UniProt IDQ24JX9
Protein RefseqThe length of the protein is 98 amino acids long.
The sequence is show below: MACCAPLCCSARTSPATTICSSDKFCRCGVCLPSTCPHTVWLLEPTCCDNCPPPCHIPQPCVPTCFLLNSSQPTPGLETINLTTYTQPSCEPCIPSCC.
For Research Use Only | Not For Clinical Use.
Online Inquiry