AibGenesis™ Mouse Anti-LOR Antibody (MO-AB-15010R)


Cat: MO-AB-15010R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15010R Monoclonal Cattle (Bos taurus), Human (Homo sapiens), Mouse (Mus musculus), Rhesus (Macaca mulatta) WB, ELISA MO15010R 100 µg
MO-DKB-00596W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rhesus (Macaca mulatta) WB, Simple Western, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Human (Homo sapiens), Mouse (Mus musculus), Rhesus (Macaca mulatta)
CloneMO15010R
SpecificityThis antibody binds to Cattle LOR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle LOR Antibody is a mouse antibody against LOR. It can be used for LOR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOR protein; LOR
UniProt IDQ17QL6
Protein RefseqThe length of the protein is 360 amino acids long.
The sequence is show below: MSHQKKQPTPQPPVGCGKTSGGSGGVFYSGGGGGSGSCGSSGGGGGGGCSGGSIKYSGGGGSSGCEGYSSGGGSSGTVCYPSGGGSSGTVCYPSGGGSSGTICHSSGGGSSGTVCYPSGGVSSGTVCHPSGGVSSGTVCHSSGGGSSGTVCYSSGGVSSGTVCHSSGGGSSGTVCYSSGGGGSSGQQVQCQSYGGVSSGGGSGCGGVSSGGGSACGVISSGDGSGCGGISSGGGCGAISSGGGSGCGGISSGGGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry