AibGenesis™ Mouse Anti-LRRC72 Antibody (MO-AB-15094R)


Cat: MO-AB-15094R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15094R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO15094R 100 µg
MO-AB-26848H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26848C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO15094R
SpecificityThis antibody binds to Cattle LRRC72.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle LRRC72 Antibody is a mouse antibody against LRRC72. It can be used for LRRC72 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeucine-rich repeat-containing protein 72; LRRC72
UniProt IDA6H759
Protein RefseqThe length of the protein is 288 amino acids long.
The sequence is show below: MARDPSHLPRACRPPAIPVRVAEAALEISRTAIEEQLKICGHKKDADVFELFLSQKELTEVIDLSRFKKLKYLWLHHNKLHGITFLTRNYCLAELYLNNNAIFDIEGLHYLPSLHILLLHHNELINLDATVKELKGMLNLKTLTLYQNPLCQYNLYRLYIIYHLPGVELLDRNQVTEKERRSMITLFNHKKAHIVQSIAFRGKVDASWDPRSPFKQKPAQRVPSDFAFANNVDKTMFDDPEDAVFVRSMKRSAMA.
For Research Use Only | Not For Clinical Use.
Online Inquiry