AibGenesis™ Mouse Anti-MS4A5 Antibody (MO-AB-16089R)


Cat: MO-AB-16089R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-16089R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO16089R 100 µg
Inquiry
MO-AB-27253H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27253C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO16089R
SpecificityThis antibody binds to Cattle MS4A5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Though this member is not expressed in hematopoietic cells specifically, it may be involved in signal transduction like many of its related family members. The gene encoding this protein is localized to 11q12, among a cluster of family members. (From NCBI)
Product OverviewMouse Anti-Cattle MS4A5 Antibody is a mouse antibody against MS4A5. It can be used for MS4A5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMembrane-spanning 4-domains, subfamily A, member 5; MS4A5
UniProt IDQ2KII2
Protein RefseqThe length of the protein is 204 amino acids long.
The sequence is show below: MDSRAAHSPVFLVFPPDITMPEFQSGDITGTTYDSSMPFPKLLATRMKILGAVQILLGAMNFSFGTVLLFTLEDPYPRFPFIFISGYPFWSSILFVNSGAFLVALERKTTETLVTLSRIMNSLSAVAAAAGIILLIIGFLIDRDFLCGYSGEVSECHAVTTLFIGILIMLMAFSIIEFLISLSFSVMRGPTECGDCEEWDGAEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry