Mouse Anti-POLB Antibody (MO-AB-18190R)
Cat: MO-AB-18190R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-18190R | Monoclonal | Cattle (Bos taurus), Chimpanzee (Pan troglodytes), E. coli (Escherichia coli ), Goat (Capra hircus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Marmoset, Rhesus (Macaca mulatta) | WB, ELISA | MO18190R | 100 µg | ||
| CBMOAB-00308FYA | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, IHC, IP, ICC | F00308FYA | 100 µg | ||
| CBMOAB-2082YC | Monoclonal | E. coli (Escherichia coli ) | WB, ELISA | MO2082YC | 100 µg | ||
| CBMOAB-54960FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO54960FYA | 100 µg | ||
| MO-AB-24036W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24036W | 100 µg | ||
| MO-AB-37970W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37970W | 100 µg | ||
| MO-AB-61897W | Monoclonal | Marmoset | WB, ELISA | MO61897W | 100 µg | ||
| MO-AB-27956H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27956C | 100 µg | ||
| MO-NAB-00427W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, IF, IHC-P, IP | NW0352 | 100 µg | ||
| MO-DKB-03611W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, IHC-P | ms2109-019 | 100 µg | ||
| MOFY-1222-FY97 | Polyclonal | Human, Mouse, Rat, Zebrafish | IP, IHC, ICC, WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Chimpanzee (Pan troglodytes), E. coli (Escherichia coli ), Goat (Capra hircus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Marmoset, Rhesus (Macaca mulatta) |
| Clone | MO18190R |
| Specificity | This antibody binds to Cattle POLB. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Thought to be involved in DNA repair and/or mutagenesis. Its processivity is enhanced by the beta sliding clamp (dnaN) and clamp loader (PubMed:1999435, PubMed:1534562). |
| Product Overview | This product is a mouse antibody against POLB. It can be used for POLB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | DNA polymerase beta; EC 2.7.7.7; EC 4.2.99.-; POLB |
| UniProt ID | Q27958 |
| Protein Refseq | The length of the protein is 335 amino acids long. The sequence is show below: MSKRKAPQETLNGGITDMLTELANFEKNVNQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLSEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESAKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRI. |
See other products for " polb "
| CBMOAB-93201FYA | Mouse Anti-polb Antibody (CBMOAB-93201FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry