AibGenesis™ Mouse Anti-PRSS37 Antibody (MO-AB-18668R)


Cat: MO-AB-18668R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18668R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO18668R 100 µg
MO-AB-28117H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28117C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO18668R
SpecificityThis antibody binds to Cattle PRSS37.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against PRSS37. It can be used for PRSS37 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProbable inactive serine protease 37; Probable inactive trypsin-X2; PRSS37; TRYX2
UniProt IDQ32KU2
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MKFTFCLTVLAGTFFSAHSSVQKDDPSPYLVYLKSHFNPCVGVLIKSNWVLAPAHCYLPNLKVMLGNLRIRIRDGTEQTINPIQIIRYWNHSHTAPQDDLMLIRLAKPAILNEKVQPIALATSTVKPGTICMLSGLDWSQNNNGRHPDLRQNLEAPVMSDTACQETEQGKSHRNSICVKFLKVFSRIFGELAVATVICKNKLQGIEVGHFMGGDVGIYTNVQKYVSWIESTTKDK.
For Research Use Only | Not For Clinical Use.
Online Inquiry