AibGenesis™ Mouse Anti-WFDC11 Antibody (MO-AB-22964R)


Cat: MO-AB-22964R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22964R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO22964R 100 µg
Inquiry
MO-AB-30026H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30026C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO22964R
SpecificityThis antibody binds to Cattle WFDC11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. (From NCBI)
Product OverviewThis product is a mouse antibody against WFDC11. It can be used for WFDC11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWAP four-disulfide core domain 11; WFDC11
UniProt IDQ32PC2
Protein RefseqThe length of the protein is 93 amino acids long.
The sequence is show below: MVNIMKFGTPLLMMLLCMVLLSVLGGVKERYSSRRELLLQECWGQPTIQECNNRCSRNFRCVKINHTCCWTYCGNVCWENTLITEEAKSLASH.
For Research Use Only | Not For Clinical Use.
Online Inquiry